bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4037_orf2 Length=127 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL011286-PA 32.0 5.1 3702.AT2G23190.1 32.0 5.7 349163.Acry_3057 31.6 8.0 > 7159.AAEL011286-PA Length=198 Score = 32.0 bits (71), Expect = 5.1, Method: Compositional matrix adjust. Identities = 29/69 (42%), Positives = 33/69 (47%), Gaps = 4/69 (5%) Query 35 FLGQNPLPCGKNHFFC--QNPFFLKKAIFVWKTIFF--WKNPFFLGKTFFFAKHHFFFKK 90 FL +N KN FF N FFL+ IFV + F KN FFL K FF FF +K Sbjct 94 FLEENKFFLAKNKFFLTKNNGFFLQNNIFVLQRTSFSCRKNSFFLQKKQFFLAETFFLQK 153 Query 91 NSNFQPPES 99 S F S Sbjct 154 TSFFSQTTS 162 > 3702.AT2G23190.1 Length=543 Score = 32.0 bits (71), Expect = 5.7, Method: Composition-based stats. Identities = 29/87 (33%), Positives = 36/87 (41%), Gaps = 13/87 (14%) Query 41 LPCGKNHFFCQNPFFLKKAIFVWKTIFFWKNPFFLGKTFFFAKHHFFFKKNSNFQPPESR 100 LPC H + K + +T F + FL FF + F K++S F P S Sbjct 31 LPCSVQHIY--------KFFDLMETHFLILSLAFL---FFISLKLLFGKRHSKFNLPPSP 79 Query 101 ANNPPPPFGGFFFFGPTPQGRLFLSFS 127 A P PF G P R FLSFS Sbjct 80 AR--PLPFIGHLHLLKQPLHRTFLSFS 104 > 349163.Acry_3057 Length=477 Score = 31.6 bits (70), Expect = 8.0, Method: Composition-based stats. Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Query 2 KNLPETPGGKRPLPPRGFFPNPPTKIFSK---ELFPFLGQNPLPCGKNH 47 K+ PE G RP+ G+FP PP S E+ +G+ LP K+H Sbjct 172 KDYPEGNMGHRPVVKGGYFPVPPVDSESDLRAEMLSTMGEMGLPIEKHH 220 Lambda K H 0.329 0.150 0.531 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22506847341 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40