bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4037_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00023179001 35.0 0.58 44689.DDB_0232084 32.7 3.3 > 99883.GSTENP00023179001 Length=2220 Score = 35.0 bits (79), Expect = 0.58, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 52 PKKNGFFQKKMVFQTKMAFFKKNGFWQKKWFLPQGRGF 89 PK+NG +KK + + M F KN F+ ++W Q F Sbjct 18 PKQNGILKKKTIPRHPMPFAAKNMFYDERWIEKQENAF 55 > 44689.DDB_0232084 Length=646 Score = 32.7 bits (73), Expect = 3.3, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 11/73 (15%) Query 30 SGGWKFEFFLKKKWCFAKKKVFPKKNGFFQKKMVFQTKMAFFKKNGFWQKK-----WFLP 84 +G W KKK K++ ++ K +F++ M FK+NGFW+ K W LP Sbjct 423 TGHWDILCLNKKKSDNWHKQI---QDMLSHSKNIFESGMDKFKQNGFWRLKQNVDPWVLP 479 Query 85 QGRGFCPRNGKSS 97 Q R G SS Sbjct 480 QKGN---RKGSSS 489 Lambda K H 0.323 0.146 0.501 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40