bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4023_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value 186103.spyM18_1611 33.1 2.4 286636.M6_Spy1335 32.7 3.2 160491.SpyM50538 32.7 3.3 30611.ENSOGAP00000000012 32.0 5.2 > 186103.spyM18_1611 Length=901 Score = 33.1 bits (74), Expect = 2.4, Method: Composition-based stats. Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Query 3 AAAASVGFAAAVRAAG-QQQMQSSSRSSSRSSSSSSSWQGPKQGHRLGLL 51 A + F +R G Q+ +S + SS+ S S WQGP H LGLL Sbjct 140 AGLQAAAFGRGIRPTGFNNQVDTSEKYSSQFSEIS--WQGPDDSHILGLL 187 > 286636.M6_Spy1335 Length=901 Score = 32.7 bits (73), Expect = 3.2, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query 7 SVGFAAAVRAAG-QQQMQSSSRSSSRSSSSSSSWQGPKQGHRLGLL 51 + F +R G Q+ +S + SS+ S S WQGP H LGLL Sbjct 144 AAAFGRGIRPTGFNNQVDTSEKYSSQFSEIS--WQGPDDSHILGLL 187 > 160491.SpyM50538 Length=901 Score = 32.7 bits (73), Expect = 3.3, Method: Composition-based stats. Identities = 18/46 (39%), Positives = 24/46 (52%), Gaps = 3/46 (6%) Query 7 SVGFAAAVRAAG-QQQMQSSSRSSSRSSSSSSSWQGPKQGHRLGLL 51 + F +R G Q+ +S + SS+ S S WQGP H LGLL Sbjct 144 AAAFGRGIRPTGFNNQVDTSEKYSSQFSEIS--WQGPDDSHILGLL 187 > 30611.ENSOGAP00000000012 Length=141 Score = 32.0 bits (71), Expect = 5.2, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 4 AAASVGFAAAVRAAGQQQMQSSSRSSSRSSSSSSSWQGPKQG 45 A A++GF+ AV A M S +R++ S W GP+ G Sbjct 53 AWAALGFSLAVYGASYHSMNSMARAAFSEDGSLIDWHGPQHG 94 Lambda K H 0.321 0.124 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22381075488 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40