bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_4020_orf2 Length=138 Score E Sequences producing significant alignments: (Bits) Value 203124.Tery_0220 37.0 0.17 10090.ENSMUSP00000030251 35.0 0.63 9913.ENSBTAP00000041176 32.3 4.6 > 203124.Tery_0220 Length=340 Score = 37.0 bits (84), Expect = 0.17, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Query 63 GCFFFPLETLKAFKTREFHITIAATVMGGPPPKKKTGFPYGGETFGLGGPIVPPGPFGRE 122 G F +E ++A K R F +T TV G PK+ F E+ + G ++ PG + E Sbjct 146 GVFQIAVEAIRAAKARRFRVTTNTTVFEGTDPKQMQEFFDFLESLNIDGMMISPG-YSYE 204 Query 123 PPISQKN 129 Q N Sbjct 205 WAPDQDN 211 > 10090.ENSMUSP00000030251 Length=721 Score = 35.0 bits (79), Expect = 0.63, Method: Composition-based stats. Identities = 23/72 (31%), Positives = 31/72 (43%), Gaps = 4/72 (5%) Query 41 PTFPKNVASVPKTLGGALPQGGGCFFFPLETLKAFKTREFHITIAAT---VMGGPPPKKK 97 P P N + PK + P+ CFF L K+ + R T+A T V GP P + Sbjct 33 PKLPGNRPTSPKISPRSSPRNSPCFFRKLLVNKSIRQRR-RFTVAHTCFDVENGPSPGRS 91 Query 98 TGFPYGGETFGL 109 P G + GL Sbjct 92 PLDPQAGSSSGL 103 > 9913.ENSBTAP00000041176 Length=292 Score = 32.3 bits (72), Expect = 4.6, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 2 QKPALFKPKGDKRDFPKTLKGPKKLGPNSFLEVA 35 +KP L GDK D K LK PK+ N FL+V+ Sbjct 136 EKPTLEASSGDKMDLMKLLKIPKETFQNIFLDVS 169 Lambda K H 0.317 0.144 0.458 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40