bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3965_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00027775001 35.8 0.43 9371.ENSETEP00000004786 33.9 1.3 69293.ENSGACP00000022417 33.5 1.7 > 99883.GSTENP00027775001 Length=748 Score = 35.8 bits (81), Expect = 0.43, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Query 4 GGPKAYFPSPFFPHPIGGFFPTTTSLGILGGPFFF-FRGGLGPNFFCSPGFPGPPGHHGG 62 G KA SP H + F T +S LGGP F R G P+ P P PP GG Sbjct 85 GAAKALDLSPGLKHTLAQF--TLSSQSSLGGPAAFSARTGHEPSQAGMPPLPSPPVLGGG 142 Query 63 PLF 65 PL Sbjct 143 PLL 145 > 9371.ENSETEP00000004786 Length=453 Score = 33.9 bits (76), Expect = 1.3, Method: Composition-based stats. Identities = 23/57 (40%), Positives = 26/57 (45%), Gaps = 14/57 (24%) Query 12 SPFFPHPIGGFFPTTTSLGILGGPFFFFRGGLGPNFFCSPGFPGPPGHHGGPLFNGR 68 +P P PIG G+ G RG +G F S G PGPPG G P F GR Sbjct 291 TPGLPGPIG-------PRGLKGD-----RGAIGS--FGSRGAPGPPGKTGNPGFPGR 333 > 69293.ENSGACP00000022417 Length=694 Score = 33.5 bits (75), Expect = 1.7, Method: Composition-based stats. Identities = 25/63 (39%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Query 4 GGPKAYFPSPFFPHPIGGFFPTTTSLGILGGPFFF-FRGGLGPNFFCSPGFPGPPGHHGG 62 G KA SP H + F T +S LGGP F R GL + P P PP GG Sbjct 78 GSAKALDLSPGLKHTLAQF--TLSSQSSLGGPAAFSARTGLEHSPGGMPPLPSPPVLGGG 135 Query 63 PLF 65 PL Sbjct 136 PLL 138 Lambda K H 0.329 0.161 0.591 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40