bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3837_orf1 Length=177 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0175 47.0 3e-04 7227.CG18497-PA 33.1 3.5 44689.DDB_0214889 32.0 8.5 > 5833.PF14_0175 Length=4662 Score = 47.0 bits (110), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 41/85 (48%), Positives = 65/85 (76%), Gaps = 8/85 (9%) Query 91 QQQPQQQGEEGQREQRWRDQEREEQLQQQR-QQEKQQQEKQQQEKQQQEKQQQQQQLLQQ 149 Q+ PQ++G D ++E+LQQ+R QQE+ QQE+ QQE+ QQE+ QQ++ L Q+ Sbjct 4191 QRVPQKKGYSTH------DMNQQERLQQERLQQERLQQERLQQERLQQERLQQER-LQQE 4243 Query 150 QLQQQQLQQQQLQQQQLQQQQLQQQ 174 +LQQ++LQQ++LQQ++LQQ++LQQ+ Sbjct 4244 RLQQERLQQERLQQERLQQERLQQK 4268 Score = 37.7 bits (86), Expect = 0.14, Method: Compositional matrix adjust. Identities = 28/56 (50%), Positives = 44/56 (78%), Gaps = 6/56 (10%) Query 122 QEKQQQEKQQQEKQQQEKQQQQQQLLQQQLQQQQLQQQQLQQQQLQQQQLQQQQLQ 177 + QQE+ QQE+ QQE+ QQ++ LQQ++LQQ++LQQ++LQQ++LQQ++LQ Sbjct 4202 HDMNQQERLQQERLQQERLQQER------LQQERLQQERLQQERLQQERLQQERLQ 4251 > 7227.CG18497-PA Length=5560 Score = 33.1 bits (74), Expect = 3.5, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 46/67 (68%), Gaps = 7/67 (10%) Query 82 FEEEDLLQQQQQPQQQGEEGQREQRWRDQE-REEQLQQQRQQEKQ-QQEKQQQEKQQQEK 139 E+DL +++Q+ E RE+ RD++ RE++++++ Q+EK+ +EK Q+E++ +EK Sbjct 2005 IREKDLREKEQR-----ERDNREKELRDKDLREKEMREKEQREKELHREKDQREREHREK 2059 Query 140 QQQQQQL 146 +Q ++ + Sbjct 2060 EQSRRAM 2066 > 44689.DDB_0214889 Length=722 Score = 32.0 bits (71), Expect = 8.5, Method: Compositional matrix adjust. Identities = 18/34 (52%), Positives = 33/34 (97%), Gaps = 0/34 (0%) Query 144 QQLLQQQLQQQQLQQQQLQQQQLQQQQLQQQQLQ 177 +QL Q+QL+Q+QL+Q+QL+++QL+Q+Q++Q+QL+ Sbjct 392 EQLKQEQLKQEQLKQEQLKKEQLKQEQIKQEQLK 425 Lambda K H 0.308 0.118 0.303 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40