bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3826_orf3 Length=94 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000014882 35.0 0.61 9258.ENSOANP00000021094 34.7 0.79 13616.ENSMODP00000007517 34.3 1.1 > 8090.ENSORLP00000014882 Length=1040 Score = 35.0 bits (79), Expect = 0.61, Method: Composition-based stats. Identities = 26/87 (29%), Positives = 37/87 (42%), Gaps = 17/87 (19%) Query 21 QRFPSISNPSPAASGHTPNGPQLFLYKGQPNHHPATLTPAAGQHP--PTVCPGP------ 72 Q P++S P+P + P P G+P+ PA + P+A P P+ P P Sbjct 144 QPTPAVSLPAPVKTSSAPVKPSATPAPGKPSSAPAPVKPSAAPAPVKPSAAPAPVKPSAA 203 Query 73 --------GPALLQLPATAGAAKVPQP 91 PA Q P++A AK P P Sbjct 204 PAPVKPSAAPATNQAPSSA-PAKAPAP 229 > 9258.ENSOANP00000021094 Length=818 Score = 34.7 bits (78), Expect = 0.79, Method: Composition-based stats. Identities = 23/79 (29%), Positives = 32/79 (40%), Gaps = 21/79 (26%) Query 25 SISNPSP----------AASGHTPNGPQLFLYKGQPNHHPATLTPAAGQHPPTVCPGPGP 74 +IS P P ++SGH+P P PA P G+ P P PGP Sbjct 690 TISTPVPPPVDDTWLQSSSSGHSPT----------PQRRPAVTVPPPGRPPAVRGPTPGP 739 Query 75 ALLQLPATAGAAKV-PQPF 92 + L T G ++ P P+ Sbjct 740 PIPVLVGTTGTLRISPNPW 758 > 13616.ENSMODP00000007517 Length=871 Score = 34.3 bits (77), Expect = 1.1, Method: Composition-based stats. Identities = 19/67 (28%), Positives = 26/67 (38%), Gaps = 0/67 (0%) Query 25 SISNPSPAASGHTPNGPQLFLYKGQPNHHPATLTPAAGQHPPTVCPGPGPALLQLPATAG 84 ++S P P T + P H P P G+ P P PGP L+ +P Sbjct 743 TVSTPVPPPVDDTWLQSSSSRHSPTPQHRPPASVPPPGRPPAVRGPTPGPPLIPVPVGVA 802 Query 85 AAKVPQP 91 A+ V P Sbjct 803 ASFVAPP 809 Lambda K H 0.318 0.137 0.481 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22695718710 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40