bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3826_orf2 Length=96 Score E Sequences producing significant alignments: (Bits) Value 203124.Tery_0382 33.1 2.2 402882.Shew185_0081 31.2 8.6 > 203124.Tery_0382 Length=783 Score = 33.1 bits (74), Expect = 2.2, Method: Composition-based stats. Identities = 14/43 (32%), Positives = 19/43 (44%), Gaps = 7/43 (16%) Query 53 SAILPHSMVEWLWDFGCSCRCRELEEGWAWAWTNCGGVLACSW 95 SA+L + W W + LE W W W+ GG+L W Sbjct 683 SAVLDGRTLLWWWP-------QALENIWVWGWSFIGGILGICW 718 > 402882.Shew185_0081 Length=131 Score = 31.2 bits (69), Expect = 8.6, Method: Compositional matrix adjust. Identities = 19/71 (26%), Positives = 35/71 (49%), Gaps = 5/71 (7%) Query 7 SISPRSGGESPAINLGGLSIIGLGEGQGVIRCFCF--RRSASFFCSHCSAILPHSMVEWL 64 SI R G ++ L G+ I+ +G+ V++C+ F + + +FCS+C H Sbjct 42 SICRRKGAIVGSVTLAGIKIL---KGEDVLKCYEFNTKTAKHYFCSNCGIYTHHQRRSNP 98 Query 65 WDFGCSCRCRE 75 ++G + C E Sbjct 99 HEYGYNIGCLE 109 Lambda K H 0.326 0.142 0.536 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22546722150 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40