bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3826_orf1 Length=94 Score E Sequences producing significant alignments: (Bits) Value 8364.ENSXETP00000016395 33.5 1.7 9258.ENSOANP00000013026 32.7 3.5 319225.Plut_0663 32.0 6.2 9031.ENSGALP00000026284 31.6 6.8 > 8364.ENSXETP00000016395 Length=371 Score = 33.5 bits (75), Expect = 1.7, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 0/54 (0%) Query 13 AGIEEGGHPGFLPASKVTKVLGAGALPIHLAQEWGGIPSNKLGGAFNHRAGGGP 66 A +E G P+ KV VLG+ L I L+ GG+P K+ FN+ P Sbjct 222 ATMEFHADKGVYPSVKVHVVLGSEDLTIKLSDRGGGVPLRKIDRLFNYMYSTAP 275 > 9258.ENSOANP00000013026 Length=179 Score = 32.7 bits (73), Expect = 3.5, Method: Compositional matrix adjust. Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 0/58 (0%) Query 13 AGIEEGGHPGFLPASKVTKVLGAGALPIHLAQEWGGIPSNKLGGAFNHRAGGGPRGHP 70 A +E LP KV LG L I ++ GG+P K+ F++ P HP Sbjct 31 ATVEMHDSSPTLPPIKVMVALGEEDLSIKMSDRGGGVPLRKIDRLFSYMYSTAPTPHP 88 > 319225.Plut_0663 Length=367 Score = 32.0 bits (71), Expect = 6.2, Method: Composition-based stats. Identities = 22/49 (44%), Positives = 29/49 (59%), Gaps = 3/49 (6%) Query 5 HFLDKK-GGAGIEEGGHPGFLPASKVTKVLGAGALPIHLAQEWGGIPSN 52 +FL + GG G GG PG LPAS V VLG G+ +H A+ G+ S+ Sbjct 145 YFLSSRFGGEGRLLGGVPGVLPASVV--VLGGGSAGMHAAKVAAGLGSS 191 > 9031.ENSGALP00000026284 Length=406 Score = 31.6 bits (70), Expect = 6.8, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query 15 IEEGGHPGFLPASKVTKVLGAGALPIHLAQEWGGIPSNKLGGAFNHRAGGGPR 67 + EG G+ P+ K LG L I ++ + GG+P K+ FN+ PR Sbjct 259 LHEGKREGY-PSIKTLVTLGKEDLSIKISDQGGGVPLRKIDRLFNYMYSTAPR 310 Lambda K H 0.322 0.149 0.492 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22695718710 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40