bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3820_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value 376686.Fjoh_3913 37.7 0.11 8364.ENSXETP00000058292 37.4 0.13 8090.ENSORLP00000000372 36.2 0.26 404589.Anae109_2032 34.3 1.0 269483.Bcep18194_C7729 34.3 1.1 9031.ENSGALP00000025315 33.9 1.5 99883.GSTENP00003404001 33.1 2.3 7955.ENSDARP00000085834 33.1 2.4 5833.PFF0935c 32.7 3.3 290402.Cbei_0559 32.7 3.4 243275.TDE0673 32.3 4.2 10116.ENSRNOP00000053813 31.6 6.9 316055.RPE_4563 31.6 7.6 69293.ENSGACP00000021684 31.6 7.7 227882.SAV6579 31.2 8.9 211586.SO_0127 31.2 9.6 > 376686.Fjoh_3913 Length=238 Score = 37.7 bits (86), Expect = 0.11, Method: Compositional matrix adjust. Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 4 CVCVCTLISRTYLLRVERQTHTHIHTHTHTHRERETHTHTHAH 46 + V +I LL +R +HT+ H+H HTH THTH HAH Sbjct 81 MLIVLGIIRLFKLLYKKRHSHTYYHSHEHTHSNGVTHTHMHAH 123 > 8364.ENSXETP00000058292 Length=483 Score = 37.4 bits (85), Expect = 0.13, Method: Composition-based stats. Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 22 QTHTHIHTHTHTHRERETHTHTHAH 46 + +T IHTHTH+H E + H H H H Sbjct 456 KIYTDIHTHTHSHVEAKVHQHQHIH 480 > 8090.ENSORLP00000000372 Length=473 Score = 36.2 bits (82), Expect = 0.26, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 0/29 (0%) Query 18 RVERQTHTHIHTHTHTHRERETHTHTHAH 46 +V + +T IHTHTH+H + + H H H H Sbjct 442 KVYPKIYTDIHTHTHSHVDGKVHQHQHIH 470 > 404589.Anae109_2032 Length=330 Score = 34.3 bits (77), Expect = 1.0, Method: Compositional matrix adjust. Identities = 29/94 (30%), Positives = 37/94 (39%), Gaps = 12/94 (12%) Query 4 CVCVCTLISRTYLLRVERQTHTHIHTHTHTHRERETHTHTHAHA----RIYMVRICIIHV 59 CV + + +LLR E H H H H RE H H H H R + +R +HV Sbjct 136 CVGLAVNLFCAFLLRDEEHGHAHGTDHLDAHDGREDHDHDHVHRGHGHRDHNLRAAYLHV 195 Query 60 YIKYIQYIER-----AHTCLG---MRPYMYIVVS 85 + + A LG M P M IV S Sbjct 196 LADAMTSVLAIVALLAGRTLGWSWMDPVMGIVGS 229 > 269483.Bcep18194_C7729 Length=353 Score = 34.3 bits (77), Expect = 1.1, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 3/33 (9%) Query 21 RQTHTHIHTHT---HTHRERETHTHTHAHARIY 50 R+ H H HTH HTHR R H HAH Y Sbjct 290 RERHEHTHTHEPLEHTHRHRHDEHHQHAHDFAY 322 Score = 33.9 bits (76), Expect = 1.5, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 16/31 (51%), Gaps = 3/31 (9%) Query 20 ERQTHTHIHT---HTHTHRERETHTHTHAHA 47 ER HTH H HTH HR E H H H A Sbjct 291 ERHEHTHTHEPLEHTHRHRHDEHHQHAHDFA 321 > 9031.ENSGALP00000025315 Length=487 Score = 33.9 bits (76), Expect = 1.5, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 22 QTHTHIHTHTHTHRERETHTHTH 44 + +T IHTHTH+H E + H H H Sbjct 460 KIYTDIHTHTHSHVEGKVHQHQH 482 > 99883.GSTENP00003404001 Length=1222 Score = 33.1 bits (74), Expect = 2.3, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Query 18 RVERQTHTHIHTHTHTHRERETHTHTHAHARIYM 51 R R THTHIH HT+T THTH H HA I + Sbjct 487 RTHRDTHTHIHAHTYTR----THTHMHIHAHIGL 516 > 7955.ENSDARP00000085834 Length=924 Score = 33.1 bits (74), Expect = 2.4, Method: Composition-based stats. Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 9/39 (23%) Query 15 YLLRVERQTHTHIHT---HTHTHRERET------HTHTH 44 Y L E+ THTHIH+ H THR T H HTH Sbjct 603 YDLSAEKNTHTHIHSNKIHKQTHRRTLTKNTVGKHLHTH 641 > 5833.PFF0935c Length=3589 Score = 32.7 bits (73), Expect = 3.3, Method: Composition-based stats. Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Query 24 HTHIHTHTHTHRERETHTHTHAHARIYMVRICIIHVYIKYIQYIER 69 H HI TH +TH+ TH +TH H + +R + I Y YI++ Sbjct 1310 HLHIRTHKNTHKY--THKYTHTHNKHSYLRSYPHPLDIYYKMYIKK 1353 > 290402.Cbei_0559 Length=468 Score = 32.7 bits (73), Expect = 3.4, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Query 19 VERQTHTHIHT-----HTHTHRERETHTHTHAH 46 +E +H+H+H H H+H E +H H H H Sbjct 88 IEDHSHSHVHDQEHDHHNHSHGEDASHNHEHNH 120 Score = 31.6 bits (70), Expect = 7.1, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 0/27 (0%) Query 20 ERQTHTHIHTHTHTHRERETHTHTHAH 46 E +H H H H H+H +H H AH Sbjct 110 EDASHNHEHNHPHSHEHDCSHNHEQAH 136 > 243275.TDE0673 Length=347 Score = 32.3 bits (72), Expect = 4.2, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query 19 VERQTHTHIHTHTHTHRERETHTHTHAHARIY 50 + + H H HT THTH THTHT +H+ ++ Sbjct 289 IRKHLHGHRHTFTHTHNGI-THTHTISHSHLH 319 > 10116.ENSRNOP00000053813 Length=239 Score = 31.6 bits (70), Expect = 6.9, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query 2 SDCVCV--CTLISRTYLLRVERQTHTHIHTHTHTHRERETHTHTHAHARI 49 DC CV C + + V THT++H HTHT++ HTHT+ H I Sbjct 182 CDCGCVWMCVYMYVFVYMHVCMYTHTNMHIHTHTYKHTYIHTHTNTHIHI 231 > 316055.RPE_4563 Length=351 Score = 31.6 bits (70), Expect = 7.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 6/34 (17%) Query 22 QTHTHIHTHTHTHRER------ETHTHTHAHARI 49 H H+H H HR E HTH H+H R+ Sbjct 302 HAHAHVHDEHHAHRHGDSDPPGEPHTHPHSHGRL 335 > 69293.ENSGACP00000021684 Length=288 Score = 31.6 bits (70), Expect = 7.7, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 10/54 (18%) Query 3 DCVCVCTLISRTYLL----------RVERQTHTHIHTHTHTHRERETHTHTHAH 46 DC+ ++R LL +V + +T IHTHTH+H + + H H H H Sbjct 232 DCLSYEDYVARQQLLLAQGGAAGAPKVYPKIYTDIHTHTHSHVDGKVHQHQHIH 285 > 227882.SAV6579 Length=574 Score = 31.2 bits (69), Expect = 8.9, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 22 QTHTHIHTHTHTHRERETHTHTHAH 46 +TH H HTH H + H+++H H Sbjct 396 ETHAHDAPHTHPHDQNHNHSNSHKH 420 > 211586.SO_0127 Length=504 Score = 31.2 bits (69), Expect = 9.6, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 10/37 (27%) Query 21 RQTHTHIHTHTH----------THRERETHTHTHAHA 47 + +H H HTH H TH +H HTH HA Sbjct 461 KHSHDHAHTHAHSTVLPTPNSPTHSHDSSHGHTHDHA 497 Lambda K H 0.332 0.138 0.473 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40