bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3629_orf8 Length=114 Score E Sequences producing significant alignments: (Bits) Value 357804.Ping_3181 31.6 7.0 > 357804.Ping_3181 Length=446 Score = 31.6 bits (70), Expect = 7.0, Method: Compositional matrix adjust. Identities = 35/111 (31%), Positives = 52/111 (46%), Gaps = 20/111 (18%) Query 10 WCPSPVLHLSHLP---LLLYAQASLLQAHSAHGYQMGTSF-HLLVLLRLQ-------PNL 58 W P PV L + P LLL+ + +A + +G S H L LR Q P+L Sbjct 116 WQPLPVEALDNEPAGALLLFREKQFSKAETGLCQHIGGSAGHALFALRRQQPLRGVIPHL 175 Query 59 LR--------FLLSLLPLLHLLLDCRKSPRIVVAKNPATLLVPLEPVVESV 101 + F++ L+ L+ + L +P VVAKNP + PL+ VVE + Sbjct 176 KQRKVLFAALFIIGLMLLMPVRLSTL-APVEVVAKNPYVVASPLDGVVEKI 225 Lambda K H 0.326 0.140 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22778399648 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40