bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3629_orf6 Length=101 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000011489 34.3 1.3 5807.cgd6_4410 31.6 7.0 > 9258.ENSOANP00000011489 Length=827 Score = 34.3 bits (77), Expect = 1.3, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Query 32 LKAASSPVVRTTNHSGSALGGGLKATITAVPECSPTDHNAV---RCSDCGKQARGICSCS 88 L A S+ +VR T+ + + + + + +PE SP AV R D G + ICS Sbjct 358 LSAISTVLVRVTDVNDNPPELTMSSVTSPIPENSPETVVAVFSIRDRDTGDNGKMICSIQ 417 Query 89 VSMPIAVTPT 98 +P A+ PT Sbjct 418 EHVPFALKPT 427 > 5807.cgd6_4410 Length=1084 Score = 31.6 bits (70), Expect = 7.0, Method: Composition-based stats. Identities = 22/83 (26%), Positives = 34/83 (40%), Gaps = 3/83 (3%) Query 6 ITPRHVSDICSHSRICIHQG--RDPVRRLKAASSPVVRTTNHSGSALGGGLKATITAVPE 63 I +H D S I + +G +DP + + + V + +G AL G +K + + Sbjct 935 IDTQHYVDTLKSSVIRVFEGVMKDPEKLFSGSHTRSVTVLSVTGGALAGFVKKGLQCM-N 993 Query 64 CSPTDHNAVRCSDCGKQARGICS 86 C C DC KQ CS Sbjct 994 CKTIIKEGPLCKDCSKQENMECS 1016 Lambda K H 0.321 0.130 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22990353331 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40