bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3629_orf3 Length=105 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G63330.2 34.7 0.87 9031.ENSGALP00000025443 33.1 2.2 290339.ESA_03428 31.2 8.5 7955.ENSDARP00000064700 31.2 9.0 > 3702.AT5G63330.2 Length=477 Score = 34.7 bits (78), Expect = 0.87, Method: Composition-based stats. Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 4/79 (5%) Query 7 PHRSHRCRAGPRPFPSNCLANTLSCHKRKEPQRLQALRSQHSNLRRQDTRLHSLSSSAVQ 66 P+ H C GPR P A + +K P +RS ++ +RL+ +S V Sbjct 104 PYNDHSCSDGPRRPPPENFATFVGSQGKKRP----PVRSDKQRNKKGPSRLNVPTSYTVA 159 Query 67 PQLLRCHRLNHRLQRYQQG 85 + C L +RL ++ G Sbjct 160 SVMKECETLLNRLWSHKSG 178 > 9031.ENSGALP00000025443 Length=684 Score = 33.1 bits (74), Expect = 2.2, Method: Composition-based stats. Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 9/82 (10%) Query 6 QPHRSHRCRAG-PRPFPSNCLANTLSCHKRKEPQRLQALRSQHSNLRRQDTRLHSLSSSA 64 +P HR RAG PR +CL + CHK ++ ++ S +S D SA Sbjct 558 EPSTFHRPRAGEPRSRAGSCLCASTCCHKEPCERKARSYGS-YSTADEPDW-------SA 609 Query 65 VQPQLLRCHRLNHRLQRYQQGC 86 P++L C L+ +++GC Sbjct 610 WPPEMLHCTECVVCLENFERGC 631 > 290339.ESA_03428 Length=346 Score = 31.2 bits (69), Expect = 8.5, Method: Composition-based stats. Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 0/42 (0%) Query 54 DTRLHSLSSSAVQPQLLRCHRLNHRLQRYQQGCRVFCHHYPW 95 D+ +H L+ +A QL+R L ++ CR F + YPW Sbjct 25 DSAVHELAFTAKPNQLIRVWDLPIGYSQFVNSCRQFHYQYPW 66 > 7955.ENSDARP00000064700 Length=762 Score = 31.2 bits (69), Expect = 9.0, Method: Composition-based stats. Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 10/73 (13%) Query 20 FPSNCLANTLSCHKRKEPQRLQALRSQHSNLRRQDTRLHSLSSSAVQPQLLRCHRLNHRL 79 + NCLA+T S P+RL SQ +H+ S +P++ R + + H Sbjct 567 YEENCLASTSSATPANSPRRLLRFSSQ----------IHNNGQSDFRPKISRENWVWHDC 616 Query 80 QRYQQGCRVFCHH 92 R+ VF H+ Sbjct 617 HRHYHSMEVFTHY 629 Lambda K H 0.327 0.131 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682427107 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40