bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3629_orf2 Length=493 Score E Sequences producing significant alignments: (Bits) Value 391774.Dvul_0667 34.7 7.1 882.DVU2580 34.7 8.5 > 391774.Dvul_0667 Length=1343 Score = 34.7 bits (78), Expect = 7.1, Method: Compositional matrix adjust. Identities = 31/76 (40%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Query 100 LPTQQPATAGYASAFTQFFGSATPAPAVPPTQPQAPAVPAGLPGFLPPLSLDFYGSPTAS 159 LP Q A G A T+ GS P+PA Q P A LP LP LSLD G+P + Sbjct 861 LPVQGVAATGADVASTEAEGSDAPSPAENRAQADTPHEMASLPPDLPTLSLD--GTPERA 918 Query 160 AVGAVATAGNAAGSAG 175 G++AT G A G Sbjct 919 --GSLATGGMTASGTG 932 > 882.DVU2580 Length=1373 Score = 34.7 bits (78), Expect = 8.5, Method: Compositional matrix adjust. Identities = 31/76 (40%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Query 100 LPTQQPATAGYASAFTQFFGSATPAPAVPPTQPQAPAVPAGLPGFLPPLSLDFYGSPTAS 159 LP Q A G A T+ GS P+PA Q P A LP LP LSLD G+P + Sbjct 891 LPVQGVAATGADVASTEAEGSDAPSPAENRAQADTPHEMASLPPDLPTLSLD--GTPERA 948 Query 160 AVGAVATAGNAAGSAG 175 G++AT G A G Sbjct 949 --GSLATGGMTASGTG 962 Lambda K H 0.316 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 212145689229 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40