bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3628_orf3 Length=102 Score E Sequences producing significant alignments: (Bits) Value 5691.Tb927.4.3890 33.1 2.5 > 5691.Tb927.4.3890 Length=1093 Score = 33.1 bits (74), Expect = 2.5, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Query 4 LGALLWL-PITTVPSLLLLLLLLVGGEA----AALRGSSTKPWGPRGPTEKKRFMEHNGG 58 +G LL L P++ +P +L+L G E+ AA SS P+ P P +K+R+ G Sbjct 720 VGRLLQLIPVSPLPGMLVLYGFFTGLESLTILAAAVTSSLSPFAPNQPEKKRRWRHDVAG 779 Query 59 AL 60 A+ Sbjct 780 AM 781 Lambda K H 0.318 0.130 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40