bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3314_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value 316057.RPD_4309 32.3 4.5 5691.Tb927.3.1610 32.3 4.6 99883.GSTENP00008087001 31.2 9.5 > 316057.RPD_4309 Length=412 Score = 32.3 bits (72), Expect = 4.5, Method: Composition-based stats. Identities = 19/58 (32%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Query 4 VCESQQQGVFAAAAAAGAAAAASPAARQQQRRRCLRGCDQQQQQQQNPYCNSFKSCSG 61 V +Q V+ A G A+P A RR+ LR D+ Q+ P+C F C G Sbjct 17 VSLAQGGAVYVPYALGGETVEAAPVAGHPDRRKLLR-VDRASPQRIAPFCPHFGICGG 73 > 5691.Tb927.3.1610 Length=659 Score = 32.3 bits (72), Expect = 4.6, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Query 32 QQRRRCLRGCDQQQQQQQN-PYCNSFKSCSGRNQMTSSNKKPQHIRR 77 Q RRC GC+++++ +++ Y +S S GR+ SN + +H+ R Sbjct 2 QPTRRCDDGCNKRRRDEEHESYRDSDTSSGGRDWRFDSNSRARHLTR 48 > 99883.GSTENP00008087001 Length=279 Score = 31.2 bits (69), Expect = 9.5, Method: Compositional matrix adjust. Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Query 37 CLRGCDQQQQQQQ--NPYCNSFKSCSGRNQMTSSNKKPQHIRRFAAGRLTAA 86 CLR Q+Q NPY N +K+CS + T+ + P H+ RL A Sbjct 177 CLRDPPSSPQRQPGCNPYPNPYKTCSRESLHTAHREAPAHLLDPGKTRLAHA 228 Lambda K H 0.320 0.122 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23067334887 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40