bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3306_orf4 Length=102 Score E Sequences producing significant alignments: (Bits) Value 9371.ENSETEP00000012745 33.5 2.0 > 9371.ENSETEP00000012745 Length=1221 Score = 33.5 bits (75), Expect = 2.0, Method: Composition-based stats. Identities = 32/104 (30%), Positives = 42/104 (40%), Gaps = 6/104 (5%) Query 1 CRPPRQTSFQKEAHHLQLPPLHL-RCFPEPQRAA--HLRPHQQKLTSCQSPPCCPQDFLL 57 C PP + P+ L P Q +A H P Q C SPP L Sbjct 1059 CSPPAPQTIALCHSPPATQPIALCHSLPPAQTSALHHSPPLAQATALCHSPPSAQSSALC 1118 Query 58 LLPLLLLSRKICWNSRPKSQIRLLQGPLPPPPLALQLGFLRGIR 101 P L + IC +S P Q+ L PP+ALQ G+++G R Sbjct 1119 YSPPLTQAAAIC-SSLP--QVAALHLNPAQPPMALQQGWVQGSR 1159 Lambda K H 0.327 0.143 0.488 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40