bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3306_orf1 Length=218 Score E Sequences producing significant alignments: (Bits) Value 9598.ENSPTRP00000011377 36.2 0.80 7159.AAEL004068-PA 32.7 9.2 > 9598.ENSPTRP00000011377 Length=859 Score = 36.2 bits (82), Expect = 0.80, Method: Composition-based stats. Identities = 29/114 (25%), Positives = 46/114 (40%), Gaps = 4/114 (3%) Query 48 QSGPPPALTTFESPGETQAVEPEGEEEEGLEEGESGSSGESSSISSETAAAEAAATGSPE 107 ++ PP T PGET+ G E ES + + + I SE ++ AA + Sbjct 261 RNAAPPPSNTEAPPGETRTEARAETRSPGKAEAESDALPDDTVIESEALPSDIAAEARAK 320 Query 108 GSKGVTDSSSTFADGGGDEQPVEALGSSGDEEEEAEDDEPLF----GNLFDEVD 157 V+D + F D E P + ++ ++E L GNL E+D Sbjct 321 TGGTVSDQALLFGDDDAGEGPSSLIREKPVPKQNENEEENLVKEQTGNLKQELD 374 > 7159.AAEL004068-PA Length=796 Score = 32.7 bits (73), Expect = 9.2, Method: Compositional matrix adjust. Identities = 33/116 (28%), Positives = 55/116 (47%), Gaps = 9/116 (7%) Query 45 RVDQSGPPPA---LTTFESPGETQAVEPEGEEEEGLEEGESGS-SGESSSISSETAAAEA 100 +VDQ PPA + +SP + + VE + E +E E S S E++ ETA + Sbjct 560 KVDQIDQPPADAEMKAVDSPEDVEMVESKSPPTEDVEMKEVASTSPEATETEKETALSND 619 Query 101 AATGSPEGSKGV---TDSSSTFADGGGDEQPVEALGSSGDEEEEAEDDEPLFGNLF 153 A+ PE ++ V T+S T + +++P +S EEEE + + N+ Sbjct 620 TASTIPETTEKVDSATESKETVS--TKEDEPTPEFETSDKEEEEMDKFKQTLSNIL 673 Lambda K H 0.302 0.126 0.349 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 57951013935 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40