bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_3224_orf3 Length=130 Score E Sequences producing significant alignments: (Bits) Value 9785.ENSLAFP00000001943 38.5 0.058 216596.RL3204 32.0 5.3 > 9785.ENSLAFP00000001943 Length=1237 Score = 38.5 bits (88), Expect = 0.058, Method: Compositional matrix adjust. Identities = 23/56 (41%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Query 74 SKVHRQHALRQLPVKRQRAFSGVWTPEQLPHHPRPLPHQLPDLFARRHLRREVHCR 129 S V + +LR LP K+ AF GVW+ QLP P+PH + RR RE+ R Sbjct 31 STVKKPRSLRTLPNKKSSAFPGVWS--QLPSTSHPVPHHASRTWNRRGQLRELRIR 84 > 216596.RL3204 Length=195 Score = 32.0 bits (71), Expect = 5.3, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Query 87 VKRQRAFSGVWTPEQLPHHPRPLPHQLPDLFAR 119 + AF GVW L H PRP +LPD+F R Sbjct 92 LDADSAFDGVWAHASLLHVPRP---ELPDVFTR 121 Lambda K H 0.330 0.141 0.479 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40