bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2748_orf2 Length=93 Score E Sequences producing significant alignments: (Bits) Value 273075.Ta1420 34.7 0.85 351607.Acel_1643 34.3 1.1 > 273075.Ta1420 Length=257 Score = 34.7 bits (78), Expect = 0.85, Method: Compositional matrix adjust. Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query 23 IVAWDEPRIY-KERIYSLSKQLQYTGRNNRAEIRLCLSRKKKHCHSNGLPHTH 74 IVA EPR+ KERI S S L N I L +S + H HS P+ + Sbjct 126 IVAMGEPRLLSKERIESFSDHLVSVCENYTGRISLIISADQAHTHSPDGPYGY 178 > 351607.Acel_1643 Length=261 Score = 34.3 bits (77), Expect = 1.1, Method: Compositional matrix adjust. Identities = 22/76 (28%), Positives = 33/76 (43%), Gaps = 4/76 (5%) Query 22 LIVAWDEPRIYKERIYSLSKQLQYTGRNNRAEIRLCLSRKKKHCHSNGL----PHTHRAS 77 LI EPR + E++ ++ TG +R L R L PH+ R Sbjct 145 LIATVHEPRRFVEKVDFITSPGYLTGEKSREAAGLIFGRVSVVITDLALMDFEPHSRRLR 204 Query 78 LCSLRRGAKAGYINAA 93 LC+++RGA + AA Sbjct 205 LCAVQRGASVEQVEAA 220 Lambda K H 0.325 0.136 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22770216990 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40