bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2433_orf2 Length=142 Score E Sequences producing significant alignments: (Bits) Value 7227.CG11790-PA 32.3 4.0 5478.CAGL0A04455g 32.3 4.1 269798.CHU_0778 32.0 5.5 > 7227.CG11790-PA Length=302 Score = 32.3 bits (72), Expect = 4.0, Method: Compositional matrix adjust. Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Query 4 VLRISMLSSGISVMRRTGIIACPLFVSATLRRVYRTQRLSRQTKSPEALRQRFVYAYLAH 63 + R++ L SGIS R G++ P F+ ++Y + S + SPEA Q +A + Sbjct 181 IARMNSLESGISTATRLGVLEAPAFIFLRQGKMY---KYSAKQYSPEAFVQ---FAEKGY 234 Query 64 RTKTIQPV 71 QPV Sbjct 235 TQSHPQPV 242 > 5478.CAGL0A04455g Length=1098 Score = 32.3 bits (72), Expect = 4.1, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 32/70 (45%), Gaps = 2/70 (2%) Query 26 PLFVSATLRRVYRTQRLSRQT--KSPEALRQRFVYAYLAHRTKTIQPVLSSRFARSLRKS 83 P + +AT TQ L Q + P +RQ YA L + P LS + S R+S Sbjct 682 PAYTAATKIVTLLTQLLKDQQLIELPIYIRQSASYASLILFKLQLSPALSDKCFESARQS 741 Query 84 VITSWKCLSN 93 ++T +C N Sbjct 742 IVTIHRCYRN 751 > 269798.CHU_0778 Length=739 Score = 32.0 bits (71), Expect = 5.5, Method: Composition-based stats. Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Query 58 YAYLAHRTKTIQPVLSSRFARSLRKSVITSWKCLSNGATLPHTTFKCHLDSN 109 +A A+ K + PVL + FA +L+ I +W GA P+ TF + DSN Sbjct 308 FALAANVYKQVDPVLYATFATTLQTKAIAAWNWA--GAN-PNVTFNNNSDSN 356 Lambda K H 0.327 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22741008115 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40