bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2378_orf1 Length=83 Score E Sequences producing significant alignments: (Bits) Value 321327.CYA_1746 33.5 1.8 > 321327.CYA_1746 Length=511 Score = 33.5 bits (75), Expect = 1.8, Method: Compositional matrix adjust. Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 5/56 (8%) Query 22 LLLLQLLLLLFSLQIFSFKIFLTLFLHLFL---FSSLLLDKRGLLRPPV--SDPGC 72 ++++ L+ + Q+F +++ L L LFL F+S+ L +RG LRPP S PG Sbjct 36 VMMMPPLIWVLGRQVFQYEMPPLLMLGLFLASYFTSMTLVRRGRLRPPTAGSQPGA 91 Lambda K H 0.332 0.146 0.472 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22659344793 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40