bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2232_orf2 Length=211 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.356 34.7 1.8 10141.ENSCPOP00000011056 33.5 4.4 9913.ENSBTAP00000010742 33.5 4.7 59463.ENSMLUP00000008729 33.1 5.8 3702.AT4G25710.1 33.1 6.0 > 5833.MAL13P1.356 Length=2223 Score = 34.7 bits (78), Expect = 1.8, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 159 GGSHSPLREPENKASPAAAAPAEAAEAPAAAGQP 192 GG +P+ +PE +A P A AP A A A A QP Sbjct 1721 GGEQTPVLKPEEEAPPPAQAPDVAPPARAPADQP 1754 > 10141.ENSCPOP00000011056 Length=2241 Score = 33.5 bits (75), Expect = 4.4, Method: Compositional matrix adjust. Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 5/58 (8%) Query 39 PRGQQRLTGGKVSEMAVCYTERSPGCSSVAGNPVGERPQASCVPSLSTSGDSFRPVSP 96 PR R GG++ Y + SPGC NPV + S + SL + FRPV+P Sbjct 1777 PRSPARKRGGRL-----LYPQNSPGCGPDTPNPVIRKVSVSRMLSLPSDSYMFRPVAP 1829 > 9913.ENSBTAP00000010742 Length=1349 Score = 33.5 bits (75), Expect = 4.7, Method: Composition-based stats. Identities = 23/72 (31%), Positives = 29/72 (40%), Gaps = 11/72 (15%) Query 127 SCCSLCKSPQTTEGPSRCTADKTPSGLLTGELGGSHSPLREPENKASPAAAA-------P 179 +C P GP CT DK SG + E G P+ E P AA P Sbjct 230 TCAEFAGEP----GPPLCTDDKEESGAMEFEDGDFDEPMEAEEVDVEPVAAKTLCQEREP 285 Query 180 AEAAEAPAAAGQ 191 AE A+ A +G+ Sbjct 286 AEEAKHKADSGK 297 > 59463.ENSMLUP00000008729 Length=1358 Score = 33.1 bits (74), Expect = 5.8, Method: Compositional matrix adjust. Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query 144 CTADKTPSGLLTGELGGSHSPLREPENKASPAAAAPAEAAEAPAAAGQPRAAG 196 C + + SGLL G LGGS P K + P E A+AP A QPR G Sbjct 1096 CWSPEEESGLLPG-LGGSRGP--SFRRKMGSEGSEPGEGAQAPGTAQQPRVQG 1145 > 3702.AT4G25710.1 Length=390 Score = 33.1 bits (74), Expect = 6.0, Method: Compositional matrix adjust. Identities = 28/90 (31%), Positives = 44/90 (48%), Gaps = 8/90 (8%) Query 82 PSLSTSGDSFRPV--SPDRSMGHQVRELSFDLKEQLHV--DTKRTRTGPSCCSLCKSPQT 137 P LS SFR + SP+ ++VR L + +L+V + + GPS +LC+ P Sbjct 48 PILSLVSKSFRSLLASPEL---YKVRSLLGRRESRLYVCINMYSYKNGPSWFTLCRKPDR 104 Query 138 TEGPSRCTADKTPSGLLTGELGGSHSPLRE 167 T S D++ SG + + HSPL + Sbjct 105 TTTSSNKEEDRS-SGYVLARIPIPHSPLTQ 133 Lambda K H 0.315 0.129 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 53680939224 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40