bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2219_orf3 Length=100 Score E Sequences producing significant alignments: (Bits) Value 393305.YE0860 33.9 1.5 7955.ENSDARP00000088699 32.7 2.9 114615.BRADO0175 32.7 3.4 7227.CG3430-PA 32.0 5.3 10116.ENSRNOP00000029472 32.0 6.1 > 393305.YE0860 Length=222 Score = 33.9 bits (76), Expect = 1.5, Method: Compositional matrix adjust. Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 7/86 (8%) Query 13 EHFHSACDHKCSS-VASVRGCE------RKAPDLTRALGVQALPDEREKRRGNLRQPEEV 65 E F+S+ + K S + ++ G + ++ D T L +QA+ R+ LR E Sbjct 68 EEFNSSFEPKWDSLIFAIMGTDAGKNICKEGHDKTTELAIQAIHKTESDRKEALRTAEAF 127 Query 66 SSSSRTARMAVDRQLKMYKELLQSLC 91 ++ +R A+ QLK+ E Q++ Sbjct 128 QEAASHSRTAITHQLKILPEYFQAVI 153 > 7955.ENSDARP00000088699 Length=383 Score = 32.7 bits (73), Expect = 2.9, Method: Compositional matrix adjust. Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 6/51 (11%) Query 13 EHFHSACDHKCSSVASVRGCERKAPDLTRALGVQALPDEREKRRGNLRQPE 63 E F +C+H+C+ V V GC P +LPD R RR +R+PE Sbjct 115 EDFQPSCEHQCTCVDGVVGCLPLCPHHI------SLPDWRCARRRLIRKPE 159 > 114615.BRADO0175 Length=385 Score = 32.7 bits (73), Expect = 3.4, Method: Compositional matrix adjust. Identities = 27/80 (33%), Positives = 38/80 (47%), Gaps = 7/80 (8%) Query 6 AVLMLPQEHFHSACDHKCS------SVASVRGCERKAPDLTR-ALGVQALPDEREKRRGN 58 A+L +H+H A D + S SV + R +A + R +LGVQA+ D K G Sbjct 81 AILDAIGKHWHVAPDVEVSLEANPTSVEATRFAGYRAAGVNRVSLGVQAMDDASLKMLGR 140 Query 59 LRQPEEVSSSSRTARMAVDR 78 L EE + AR A +R Sbjct 141 LHTAEEAMKAVAIARGAFER 160 > 7227.CG3430-PA Length=605 Score = 32.0 bits (71), Expect = 5.3, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 0/45 (0%) Query 42 ALGVQALPDEREKRRGNLRQPEEVSSSSRTARMAVDRQLKMYKEL 86 A GVQ LP +LRQP E+ + +AV + L+M +L Sbjct 274 AFGVQVLPHANPLLDKSLRQPTEICEETYPTHLAVHKDLRMLLKL 318 > 10116.ENSRNOP00000029472 Length=931 Score = 32.0 bits (71), Expect = 6.1, Method: Compositional matrix adjust. Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 1/64 (1%) Query 26 VASVRGCERKAPDLTRALGVQA-LPDEREKRRGNLRQPEEVSSSSRTARMAVDRQLKMYK 84 VAS R E K DL +GV++ P E GN E+ + + + A D QL K Sbjct 48 VASARSSEEKDGDLGLQVGVKSDSPSEMHLNNGNFSSEEDDADTQESKTKATDPQLSQKK 107 Query 85 ELLQ 88 + Q Sbjct 108 SITQ 111 Lambda K H 0.319 0.128 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23067334887 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40