bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2038_orf1 Length=77 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000004835 33.5 1.7 > 8090.ENSORLP00000004835 Length=901 Score = 33.5 bits (75), Expect = 1.7, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 0/34 (0%) Query 44 IARNISAYVCGHATMFTSLFASSIIPFHRASVKM 77 + RN + CG +FT L+A S P H ASV++ Sbjct 680 LGRNPTFSSCGEDILFTGLYADSNTPHHSASVEL 713 Lambda K H 0.330 0.135 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23091434817 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40