bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2031_orf2 Length=124 Score E Sequences producing significant alignments: (Bits) Value 335284.Pcryo_0860 35.4 0.50 251221.gll3173 33.5 1.8 31033.SINFRUP00000144341 32.3 4.7 > 335284.Pcryo_0860 Length=348 Score = 35.4 bits (80), Expect = 0.50, Method: Compositional matrix adjust. Identities = 31/116 (26%), Positives = 50/116 (43%), Gaps = 8/116 (6%) Query 5 PASCGGVD-AENCVALRCTGSSGSWYEIPKRVHRRCSTRNMSVRSRKTLGALPQPSTALS 63 P S +D A + C ++Y++ + R R +S + KT + S Sbjct 169 PKSQPKIDSAHQSGNIFCAAGGSAFYDLGLLLIERYCGREISTQVAKTQIIDSKRGNQNS 228 Query 64 HTVISIHRPG----CTSVMYMLNESFTKSI---GLAAMALRIPASKKRSACSCVRM 112 +T +++H+P V + E+F +SI GLAAM P + R SCV M Sbjct 229 YTNVTLHKPHSDQLVKQVQEFIEENFKQSIQVSGLAAMVNITPRTLNRRFQSCVAM 284 > 251221.gll3173 Length=288 Score = 33.5 bits (75), Expect = 1.8, Method: Compositional matrix adjust. Identities = 22/74 (29%), Positives = 35/74 (47%), Gaps = 8/74 (10%) Query 8 CGGVDAENC---VALRCTGSSGSWYEIPK---RVHRRCSTRNMSVRSRKTLGALPQPS-- 59 C GV A++ + G G W ++ + R+HR S++ R T+G+ PQP+ Sbjct 79 CSGVAADSAYLVIEWLPLGGRGDWEQLGEQLARLHRTISSKGFGWRRDNTIGSTPQPNPW 138 Query 60 TALSHTVISIHRPG 73 TA + HR G Sbjct 139 TADWAAFFARHRIG 152 > 31033.SINFRUP00000144341 Length=181 Score = 32.3 bits (72), Expect = 4.7, Method: Compositional matrix adjust. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 4/34 (11%) Query 26 GSWYEIPKRVHR----RCSTRNMSVRSRKTLGAL 55 G+WYEI + HR +CST N S++S +G L Sbjct 43 GTWYEIQRLPHRFQMGQCSTANYSLKSPGVVGVL 76 Lambda K H 0.321 0.129 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40