bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2023_orf6 Length=109 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000000610 34.3 1.1 9031.ENSGALP00000034726 31.6 6.6 > 9031.ENSGALP00000000610 Length=324 Score = 34.3 bits (77), Expect = 1.1, Method: Compositional matrix adjust. Identities = 28/96 (29%), Positives = 47/96 (48%), Gaps = 5/96 (5%) Query 7 QLSWELFLLPLPPRFAALAASLGGFAAAEWPGGPAAAALLLLLLLLLLLLRMSPRR-RRR 65 ++ E+ P PP +A+ AE GG AAA +++++L + LL RR +R Sbjct 207 NVTLEVIPRPAPPGDNGIASRA---LVAEVAGGCAAAIVIIIVLTVSFLLVAQRRRMQRD 263 Query 66 RRPGALQRRSRGARRKAAAAALQQL-FTALQPLSPS 100 RPGA R + + + + L + LQ ++PS Sbjct 264 ERPGATSRNPEAVQFQVSPGDSEGLTYAQLQAVTPS 299 > 9031.ENSGALP00000034726 Length=324 Score = 31.6 bits (70), Expect = 6.6, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 3/65 (4%) Query 39 GPAAAALLLLLLLLLLLLRMSPRRR--RRRRPGALQRRSRGARRKAAAAALQQL-FTALQ 95 G AAA++++++L + LL ++ RRR R PGA R + + + + L + LQ Sbjct 235 GGCAAAIVIIIVLTVSLLLVAQRRRMQRDESPGATSRSPEAVQFQVSPGDSEGLTYAQLQ 294 Query 96 PLSPS 100 ++PS Sbjct 295 AVTPS 299 Lambda K H 0.327 0.138 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22374500883 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40