bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_2023_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value 247156.nfa8640 37.0 0.16 5671.LinJ29.1790 32.7 3.6 5518.FG01043.1 32.3 4.4 > 247156.nfa8640 Length=859 Score = 37.0 bits (84), Expect = 0.16, Method: Composition-based stats. Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 0/37 (0%) Query 39 PASPLQRPRATTTAPSRGHPQQQQQQQQQQQQRSSSR 75 PA+P QRP APS+G PQQ Q + Q+ S R Sbjct 102 PAAPAQRPHPPQGAPSQGSPQQGAPQHRPPQRPSYQR 138 > 5671.LinJ29.1790 Length=1413 Score = 32.7 bits (73), Expect = 3.6, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 11/65 (16%) Query 48 ATTTAPSRGHPQQQQQQQQQQQQRSSSRASGPFC----------CRKTPKAGSKCSKSWR 97 ATTT P PQ + QQ+ + ++S S PF CR P G C+ S+ Sbjct 196 ATTTTPVLASPQNESQQRSAKSSTAASH-SNPFFPPQDEVVQQQCRSHPSNGVSCATSFS 254 Query 98 KWKQE 102 W ++ Sbjct 255 SWARQ 259 > 5518.FG01043.1 Length=724 Score = 32.3 bits (72), Expect = 4.4, Method: Compositional matrix adjust. Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 0/46 (0%) Query 32 CCFSSRPPASPLQRPRATTTAPSRGHPQQQQQQQQQQQQRSSSRAS 77 +SSR P+SP+Q P +T+ HPQ+ + ++ S+ S Sbjct 121 ASYSSRDPSSPIQTPSSTSAEAHDSHPQRDSSEHNSSERGSTDSYS 166 Lambda K H 0.320 0.127 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40