bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1973_orf5 Length=113 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL003039-PA 35.8 0.43 > 7159.AAEL003039-PA Length=510 Score = 35.8 bits (81), Expect = 0.43, Method: Composition-based stats. Identities = 32/114 (28%), Positives = 47/114 (41%), Gaps = 20/114 (17%) Query 1 QQLLLHFRAHFASFRLGFIPSPRGG-------EVSARRARG--ERALPS---------VH 42 +Q++L +AH + LG PSP GG + AR+ + LP H Sbjct 179 EQMILKHKAHENT--LGIKPSPSGGLDFYYATDAHARKMVDFVQAVLPVKVTNSKKLISH 236 Query 43 SFHKTETNDKYIYLVLIYPVISASLVRIGKWRRAQLGCTCTSVVRGHAAAAIQL 96 H N KY Y + + P+ SLV + K + QLG + A A+ L Sbjct 237 DIHSNSYNYKYSYALDVVPISKGSLVCLNKKLQQQLGHISPICLVTKVANAVHL 290 Lambda K H 0.329 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22857864480 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40