bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1973_orf3 Length=103 Score E Sequences producing significant alignments: (Bits) Value 9365.ENSEEUP00000011426 34.3 1.2 9785.ENSLAFP00000004171 32.0 5.0 > 9365.ENSEEUP00000011426 Length=992 Score = 34.3 bits (77), Expect = 1.2, Method: Compositional matrix adjust. Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 7/93 (7%) Query 2 SEARRRRARKAPPARLSQRPITLQIYSPQIYSNLKAKFSEWSGSSSRPG----APCRWTR 57 ++ RRR K A L+Q+ +TL Q Y K +E S P A C+ T Sbjct 138 TQELRRRMGKVDRAGLTQKVLTLCGCHLQSYIQAKEAMAEKHSGVSNPAKLWEAYCQITS 197 Query 58 P---VSSQSTSPDPSRASLERFCHTFLPRPRCE 87 P + S ST +RA ++ H +P+P E Sbjct 198 PHPAMQSPSTEVSYTRAIVDVLLHGLVPKPHLE 230 > 9785.ENSLAFP00000004171 Length=1509 Score = 32.0 bits (71), Expect = 5.0, Method: Compositional matrix adjust. Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 14/69 (20%) Query 4 ARRRRARKAPPARLSQRPITLQIYSPQIYSNLKAKFSEWSGSSSRPGAPCRWTRPVSSQS 63 R+ +A KAP A++++ + + +LKA++ E +G PG +P SSQ+ Sbjct 835 VRKLKAEKAPKAKVNE--------AVECLLSLKAQYKEKTGKEYIPG------QPSSSQN 880 Query 64 TSPDPSRAS 72 + P P+R+S Sbjct 881 SDPGPTRSS 889 Lambda K H 0.318 0.130 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22836390219 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40