bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1902_orf3 Length=180 Score E Sequences producing significant alignments: (Bits) Value 4932.YMR221C 37.7 0.18 8364.ENSXETP00000016237 36.2 0.53 10141.ENSCPOP00000012712 32.7 5.3 > 4932.YMR221C Length=504 Score = 37.7 bits (86), Expect = 0.18, Method: Compositional matrix adjust. Identities = 31/116 (26%), Positives = 49/116 (42%), Gaps = 18/116 (15%) Query 63 NWIP------FLSFYEACTCAVSSCQLPSPPTQGNQVAQHRKVMRSVLVKPCGRMFGLRQ 116 NW P F + Y + +CQL P + H + + V+ GL + Sbjct 177 NWFPTLNVSRFFTLYLIVPVFILACQLTIMPHSSYKTVNH---IAKIAVE------GLDE 227 Query 117 NGKLKRGILCLGAALKQQLRVRLGAVEREERRLGPEPMYKETKFFVF---KLERKS 169 NG+L G G +Q R L A+EREE + P +++ + KL++KS Sbjct 228 NGRLIEGDTGSGIIPDEQERQSLIAIEREEDSIPSRPQRRKSVLETYVEDKLQKKS 283 > 8364.ENSXETP00000016237 Length=3200 Score = 36.2 bits (82), Expect = 0.53, Method: Composition-based stats. Identities = 22/60 (36%), Positives = 26/60 (43%), Gaps = 5/60 (8%) Query 61 DINWI--PFLSFYEACTCAVSSCQLPSPPTQGNQVAQHRKVMRSVLVKPCGRMFGLRQNG 118 D+ W+ P S ACT V C LP+PP N Q M S PC G + NG Sbjct 213 DVGWMSPPGSS---ACTADVDECALPNPPCSQNPPVQCINTMGSFTCGPCPTDKGWQGNG 269 > 10141.ENSCPOP00000012712 Length=421 Score = 32.7 bits (73), Expect = 5.3, Method: Compositional matrix adjust. Identities = 34/107 (31%), Positives = 50/107 (46%), Gaps = 18/107 (16%) Query 52 HEIIHRGSSDIN---WIPFLSFYEACTCAVSSCQLPSPPTQGNQVAQHRKVMRSVLVKPC 108 HEI+ RGSS N W P + Y+ + + Q PSP +QG ++Q +V+ L + Sbjct 107 HEILTRGSSPANASKWSPPQN-YKKRVATLEAKQKPSPQSQG--LSQQDQVIAERLAR-- 161 Query 109 GRMFGLRQNGKLKR-----GILCLGAALKQQLRVRLGAVEREERRLG 150 LRQ K K I AALK + R + +++ E RL Sbjct 162 -----LRQENKPKSVPSQAEIEARLAALKDEPRGPITSIQEMETRLA 203 Lambda K H 0.326 0.141 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37047630060 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40