bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1775_orf6 Length=197 Score E Sequences producing significant alignments: (Bits) Value 9598.ENSPTRP00000027988 33.5 3.4 > 9598.ENSPTRP00000027988 Length=501 Score = 33.5 bits (75), Expect = 3.4, Method: Compositional matrix adjust. Identities = 16/64 (25%), Positives = 28/64 (43%), Gaps = 0/64 (0%) Query 26 TPLSRQSQSRQVCLSKSWAAAAAAAAAPRFPAASFSRKLHFFASVLYQKTCDLLLLLLLQ 85 TP+ Q +S + C ++ P +H A ++ C LLL+L++ Sbjct 84 TPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDVDGPIHHKALLISVTVCSLLLVLIIL 143 Query 86 FCHF 89 FC+F Sbjct 144 FCYF 147 Lambda K H 0.326 0.139 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 46738269100 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40