bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1775_orf4 Length=115 Score E Sequences producing significant alignments: (Bits) Value 335543.Sfum_0390 32.7 3.0 > 335543.Sfum_0390 Length=721 Score = 32.7 bits (73), Expect = 3.0, Method: Composition-based stats. Identities = 21/80 (26%), Positives = 34/80 (42%), Gaps = 2/80 (2%) Query 32 WLQLQPPPPRPAIRCGIRGKAKQKVAKLQQQQQQQIASLLIKNRSKKMKLSGETCCRKSG 91 W ++ PP P P +R G+ G A +Q + + LL R + G+TCC Sbjct 465 WEKINPPVPNPRLRVGLFGGCLVDFA--YPEQAEALIRLLEGRRIRLEYPMGQTCCGLPA 522 Query 92 CSSSSRRRRPRLGKTNLPAL 111 ++ R+ NL A+ Sbjct 523 KMTAEDETARRVAAQNLRAM 542 Lambda K H 0.324 0.134 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22698934816 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40