bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1775_orf2 Length=103 Score E Sequences producing significant alignments: (Bits) Value 309807.SRU_0062 33.5 1.8 316056.RPC_3502 31.6 7.5 > 309807.SRU_0062 Length=286 Score = 33.5 bits (75), Expect = 1.8, Method: Compositional matrix adjust. Identities = 17/63 (26%), Positives = 29/63 (46%), Gaps = 0/63 (0%) Query 19 SRGVGSFPGAGVAALRRPAAFWCFRIFSSFWPFKTEFKPITPFRSLFTFHFNSRSSLKPL 78 R +G P +A+ +RP A +F+S P P ++L T F++ S + + Sbjct 159 GRSMGGGPATWIASRKRPGAVILESVFTSVPDVGAHHYPFLPVQTLATNQFDNASRVGAI 218 Query 79 SIP 81 S P Sbjct 219 SAP 221 > 316056.RPC_3502 Length=410 Score = 31.6 bits (70), Expect = 7.5, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 0/42 (0%) Query 13 FFLDCASRGVGSFPGAGVAALRRPAAFWCFRIFSSFWPFKTE 54 F+L VG F AG A RP FW + SS WP + + Sbjct 297 FWLATRPDWVGEFSLAGALATTRPLGFWWAAVPSSRWPAEAQ 338 Lambda K H 0.338 0.146 0.484 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22836390219 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40