bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1775_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value 257363.RT0204 37.7 0.11 272947.RP213 35.8 0.37 > 257363.RT0204 Length=375 Score = 37.7 bits (86), Expect = 0.11, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 0/61 (0%) Query 21 KFNSRSSRVPVPVLIPSLSRVCLANWNWLCNSNRTSNLSSIPKNSNSNSSSNSSSSSSSS 80 KF + +P+P I S VC +N C+ + T ++SI NSN+ + ++ S S+ Sbjct 131 KFLDKYGEMPLPFYIKRTSSVCCSNMALFCDHDNTLKITSISHNSNTVNFRSTDSMIDST 190 Query 81 S 81 + Sbjct 191 N 191 > 272947.RP213 Length=383 Score = 35.8 bits (81), Expect = 0.37, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 0/61 (0%) Query 21 KFNSRSSRVPVPVLIPSLSRVCLANWNWLCNSNRTSNLSSIPKNSNSNSSSNSSSSSSSS 80 KF + +P+P I S VC +N C T + SIP N + ++NS++ + S Sbjct 131 KFLDKYGEIPLPFYIKRPSPVCYSNMALCCKPENTLKIKSIPHNMSKIVTNNSNTVNLRS 190 Query 81 S 81 + Sbjct 191 N 191 Lambda K H 0.311 0.121 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40