bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1636_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 357808.RoseRS_3886 32.7 3.2 9685.ENSFCAP00000008797 32.3 4.4 362976.HQ1691A 31.6 6.6 > 357808.RoseRS_3886 Length=464 Score = 32.7 bits (73), Expect = 3.2, Method: Composition-based stats. Identities = 21/79 (26%), Positives = 34/79 (43%), Gaps = 6/79 (7%) Query 2 PPSKFITLDIHCFNSAATSSFSACAALSCFWRELQRCSSSRRSVVASPRVLLSSSSLLLE 61 P + +TLD C N S A + L +R V+ P VLL E Sbjct 112 PEKRRVTLDCQCINQHGEVVISGNAEV------LAPTEKVKRQRVSLPEVLLHKPGANYE 165 Query 62 ALLLLAAAVGRTKDLLLFP 80 A++ A+++G + ++FP Sbjct 166 AIIKRASSLGPVRAAVVFP 184 > 9685.ENSFCAP00000008797 Length=898 Score = 32.3 bits (72), Expect = 4.4, Method: Composition-based stats. Identities = 29/82 (35%), Positives = 38/82 (46%), Gaps = 8/82 (9%) Query 18 ATSSFSACAALSCFWRELQRCSSSRRSVVASPRVLLSSSSLLLEALLLLAAAVGRTKDLL 77 A ++ AC LS W +LQ C R + +AS R L +L +L A +DL Sbjct 430 ALRAWRACWRLS--WEQLQPCLD-RAATLASRRDLFFRQALHKARRVLEA-----RQDLS 481 Query 78 LFPLFRLAERNACSGISKLSLD 99 L PL R A R C G +LD Sbjct 482 LCPLIRAAVREGCPGPLLATLD 503 > 362976.HQ1691A Length=431 Score = 31.6 bits (70), Expect = 6.6, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Query 47 ASPRVLLSSSSLLLEALLLLAAAVGRTKDL---LLFPLFRLAERNACSGISKLSL 98 A V+ S + ++EA+ L +A+GRT + + PLF +A R A G +L+L Sbjct 233 ADLHVIEISHTDIIEAIPQLVSAIGRTNPMDLAITVPLFIVARRVAADGFDRLAL 287 Lambda K H 0.322 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40