bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0862_orf1 Length=101 Score E Sequences producing significant alignments: (Bits) Value 211586.SO_0412 33.9 1.4 33169.AGOS_AGL091W 33.5 1.9 > 211586.SO_0412 Length=244 Score = 33.9 bits (76), Expect = 1.4, Method: Compositional matrix adjust. Identities = 25/100 (25%), Positives = 46/100 (46%), Gaps = 11/100 (11%) Query 11 IFPESETSRVRELRRLRRVVRALCNSVSGNHRHSERRPAVQ-CGLLDQCDSSSRETRP-- 67 ++ + ++R RL + + LCN+++ +H+H P C L ++CD + + Sbjct 5 VYEQPLNEKIRSYLRLEYLSKQLCNNLNNDHQHRCFYPLFSLCELSERCDYRNEVLKDIE 64 Query 68 RQLQRRCTGKELHRTEVKQLEKY--------ESEERPCTC 99 R L + +EL + KQ+ Y ES +RP C Sbjct 65 RNLLQLSKWQELEHIDSKQITFYIEALTQARESLQRPERC 104 > 33169.AGOS_AGL091W Length=866 Score = 33.5 bits (75), Expect = 1.9, Method: Composition-based stats. Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 4/52 (7%) Query 31 RALCNSVSGNHRHSERRPAVQCGLLDQCDS--SSRET--RPRQLQRRCTGKE 78 + + N V+GN ++P VQC L+Q S S R T +PRQ Q+R +G + Sbjct 345 QQISNVVTGNTSMLSKQPLVQCSSLEQQHSRASGRSTQHQPRQAQQRHSGSQ 396 Lambda K H 0.319 0.133 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22990353331 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40