bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0763_orf2 Length=146 Score E Sequences producing significant alignments: (Bits) Value 266834.SMc02494 33.1 2.4 114615.BRADO6212 31.6 7.3 > 266834.SMc02494 Length=509 Score = 33.1 bits (74), Expect = 2.4, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 17/23 (73%), Gaps = 0/23 (0%) Query 110 PSASAMLFHNHHVAILGLARGFF 132 PSA +L+H+H A++GL RGF Sbjct 482 PSAGQLLYHDHFEAVIGLYRGFL 504 > 114615.BRADO6212 Length=429 Score = 31.6 bits (70), Expect = 7.3, Method: Compositional matrix adjust. Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 14/68 (20%) Query 7 KKKYLWKSGKETLIRDSLWGVRTPRPQRAS---THSDATARSFY-----------FISFY 52 ++ ++W ++ L D G++TP+P + T SDA R +Y I Y Sbjct 152 RRMFIWAVAQKILAVDPTEGIKTPKPAKTEGFVTWSDADVRRYYKRWPLGTRERVMIDVY 211 Query 53 LFFLFKKS 60 LF F++ Sbjct 212 LFTGFRRG 219 Lambda K H 0.330 0.140 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40