bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0672_orf14 Length=63 Score E Sequences producing significant alignments: (Bits) Value 94122.Shewana3_2640 35.4 0.46 > 94122.Shewana3_2640 Length=782 Score = 35.4 bits (80), Expect = 0.46, Method: Composition-based stats. Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 2/53 (3%) Query 2 SSFVLFHLFMKFANKHVLFFTLLLLFKGRIFSFLIRYSLSRAY-LHETVFRGS 53 +S +LF LF+ AN H +L+LLF+ +FSF++ + L + Y +TVF+ + Sbjct 65 ASLILFSLFVALANPHYFTASLVLLFE-YLFSFVVLFLLHKEYQFIKTVFKAT 116 Lambda K H 0.340 0.149 0.446 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23199090908 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40