bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0662_orf2 Length=113 Score E Sequences producing significant alignments: (Bits) Value 293826.Amet_3511 33.1 2.5 9258.ENSOANP00000021251 32.0 5.8 > 293826.Amet_3511 Length=518 Score = 33.1 bits (74), Expect = 2.5, Method: Composition-based stats. Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Query 12 ICSNPDEGARLGYANVHHTAAEMHQLSSHVRPPQWQVLCLTTNYGSILKNFRGPLQGPSS 71 + +NPDE +LG +N++ T + L+ W+ + + GS+L F G L GP + Sbjct 228 VITNPDEVGQLGESNINKTDLKEEGLTLKELLGSWRGITI----GSLLGTFLGALPGPGA 283 Query 72 PAA 74 A Sbjct 284 TLA 286 > 9258.ENSOANP00000021251 Length=1262 Score = 32.0 bits (71), Expect = 5.8, Method: Compositional matrix adjust. Identities = 26/89 (29%), Positives = 37/89 (41%), Gaps = 6/89 (6%) Query 16 PDEGARLGYANVHH-----TAAEMHQLSSHVRPPQWQVLCLTTNYGSILKNFRGPLQGPS 70 PD LGY+ + T ++ L+S QW + T G LK +R S Sbjct 791 PDPDTILGYSGEDYPKAPPTEVKVRVLNSTAVSLQWNRVYPDTVQGQ-LKEYRAYFWRES 849 Query 71 SPAAHGNMDSEAEWTAVPPDRSRESRDGL 99 S H + + +WT+ P DR R GL Sbjct 850 SLLKHLRVSPKKQWTSFPGDRLRGVVSGL 878 Lambda K H 0.314 0.130 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22857864480 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40