bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0662_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value 5270.UM05839.1 36.6 0.25 13616.ENSMODP00000015014 32.3 4.6 251221.glr0817 32.0 5.0 43179.ENSSTOP00000013616 32.0 6.0 > 5270.UM05839.1 Length=1434 Score = 36.6 bits (83), Expect = 0.25, Method: Compositional matrix adjust. Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 6/92 (6%) Query 21 GPVVQRSIQPRSP---YFRVQQEKMDPEAGRESSSELNRNWLSDKEPAIAAGER--EKTT 75 G + ++ PR P FR+ + + AGR+S L + +E A+ A ER + Sbjct 1075 GSTREATVTPRQPATYVFRISKRGLADAAGRDSRMRLTVEYRGLQEDAVCAAERALDALV 1134 Query 76 GAFPQLYGVHLRNPSEPLHLD-LSIYVHQRAD 106 A L G+ P+ L D L +YV +R D Sbjct 1135 EADAALEGLKTGTPTRRLLQDALVVYVRERLD 1166 > 13616.ENSMODP00000015014 Length=359 Score = 32.3 bits (72), Expect = 4.6, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 0/47 (0%) Query 67 AAGEREKTTGAFPQLYGVHLRNPSEPLHLDLSIYVHQRADNSTTVRA 113 A+GE ++ G P G+HL P L +VH++A+ +T VR Sbjct 150 ASGESPRSPGHLPSSRGLHLSEPGSGRQPSLRAHVHKQAEKTTRVRT 196 > 251221.glr0817 Length=569 Score = 32.0 bits (71), Expect = 5.0, Method: Compositional matrix adjust. Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Query 41 KMDPEAGRESSSELNRNWLSDKEPAIAAGERE----KTTGAFPQLYGVHLRNPSEP 92 ++DPE RE +S L ++ +K+PA + +T AF Q Y V L+ P P Sbjct 103 EVDPEGNRERASGLRNRFVGEKDPASLIESSKLFLNETDNAFYQDYLVQLKKPLNP 158 > 43179.ENSSTOP00000013616 Length=1131 Score = 32.0 bits (71), Expect = 6.0, Method: Composition-based stats. Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 13/92 (14%) Query 19 WNGPVVQRSIQPRSPYFRVQQEKMDPEAGRESSSELNRNWLSDKEPAI-----------A 67 W G +Q + S R+ QE+ + ++ +E S+ N N +S+K I Sbjct 77 WKGGTLQIQLAKESFLHRLAQEREEVKSKKEKSTTGNTN-VSEKMGGIDFQMKAVPGTEV 135 Query 68 AGEREKTTGAFPQLYGV-HLRNPSEPLHLDLS 98 G + F ++ V HL+N +PL LDLS Sbjct 136 PGHKNWVVSKFGRVLPVLHLKNQHKPLFLDLS 167 Lambda K H 0.315 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40