bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0641_orf2 Length=94 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G09080.1 33.5 1.9 > 3702.AT3G09080.1 Length=1026 Score = 33.5 bits (75), Expect = 1.9, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 12/73 (16%) Query 27 AGRVACFLFLCTGVSFTSWLQDATFAGHGSDQLSGDCVLANTSIMVDVANLNCILAWQLS 86 + R CF+ TG + AT GHG + ++G L + ++ VA+ CI W+L Sbjct 590 SNRTICFVDFVTG----ELVAQAT--GHG-EAVTGVIFLPDCKHIISVASDGCIFVWKLP 642 Query 87 IRM-----RAANE 94 +RM RA NE Sbjct 643 LRMATRIIRAVNE 655 Lambda K H 0.330 0.138 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22695718710 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40