bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0562_orf8 Length=145 Score E Sequences producing significant alignments: (Bits) Value 10090.ENSMUSP00000041374 32.3 4.5 9615.ENSCAFP00000013307 32.0 5.8 > 10090.ENSMUSP00000041374 Length=749 Score = 32.3 bits (72), Expect = 4.5, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 19/47 (40%), Gaps = 0/47 (0%) Query 2 NFAGPRGLQRGVRTPRGGVLRGAACRSSSSCCCCCCSCCCCCSCCCF 48 NF G G+Q R P G++ + C C S C C CF Sbjct 494 NFTGTSGIQTQARLPFNGIIPSESTSRPRKPCNCTKSLCLKLYCDCF 540 > 9615.ENSCAFP00000013307 Length=761 Score = 32.0 bits (71), Expect = 5.8, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 19/47 (40%), Gaps = 0/47 (0%) Query 2 NFAGPRGLQRGVRTPRGGVLRGAACRSSSSCCCCCCSCCCCCSCCCF 48 NF G G+Q R P G++ + C C S C C CF Sbjct 506 NFTGTPGIQTQARLPFNGIIPSESASRPRKPCNCTKSLCLKLYCDCF 552 Lambda K H 0.334 0.141 0.525 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22480264135 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40