bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0469_orf2 Length=200 Score E Sequences producing significant alignments: (Bits) Value 246197.MXAN_1193 39.7 0.053 4932.YCR093W 38.1 0.15 51511.ENSCSAVP00000007199 36.2 0.55 387093.SUN_1059 34.3 2.6 5691.Tb927.6.610 32.7 6.1 381666.H16_A1986 32.3 9.4 > 246197.MXAN_1193 Length=1219 Score = 39.7 bits (91), Expect = 0.053, Method: Compositional matrix adjust. Identities = 27/80 (33%), Positives = 39/80 (48%), Gaps = 4/80 (5%) Query 96 RAVLAAALAAAPGISTPEAAAVVAGNSTSRAAAQRVGPLCCRLLQHVCTQVKATLLLHVQ 155 R L AA+AA P + PEA +A + R +RV PL +L+ V A L+L Sbjct 361 RRFLEAAIAADPAM--PEARVALADHELDRGHPERVQPLVAPVLEKTPDDVNARLVLARA 418 Query 156 HQQL--RPEAEVFPDTAFAM 173 H+ L RP+A + F + Sbjct 419 HEALGERPKAHALVEETFRL 438 > 4932.YCR093W Length=2108 Score = 38.1 bits (87), Expect = 0.15, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 > 51511.ENSCSAVP00000007199 Length=771 Score = 36.2 bits (82), Expect = 0.55, Method: Composition-based stats. Identities = 27/78 (34%), Positives = 41/78 (52%), Gaps = 8/78 (10%) Query 130 RVGPLCCRLLQHVCTQV-----KATLLLHVQH-QQLRPEAEVFPDTAFAMDEVACLLAQD 183 RVG C + Q + QV +A LL + + R VF +T D +AC+L+Q+ Sbjct 533 RVGGACTDVTQSI-IQVDQDDKRAKLLELISDVAETRSRTLVFVETKRGADFLACMLSQE 591 Query 184 GAPNGSDNG-RQQQQQQQ 200 G P S +G R QQ+++Q Sbjct 592 GCPTTSIHGDRLQQEREQ 609 > 387093.SUN_1059 Length=152 Score = 34.3 bits (77), Expect = 2.6, Method: Compositional matrix adjust. Identities = 21/79 (26%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Query 95 LRAVLAAALAAAPGISTPEAAAVVAGNSTSRAAAQRVGPLCCRLLQHVCTQVKATLLLHV 154 ++ ++ +L AA I P AAA A + A + G + + L+ + + + ++L V Sbjct 1 MKKIITISLLAALSI-MPLAAANAATSKLIELAKKESGEISAKKLKIMLDKEEPVIILDV 59 Query 155 QHQQLRPEAEVFPDTAFAM 173 + + R E E+F D FA+ Sbjct 60 REAEQRAEGEIFADEYFAI 78 > 5691.Tb927.6.610 Length=579 Score = 32.7 bits (73), Expect = 6.1, Method: Compositional matrix adjust. Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 5/77 (6%) Query 104 AAAPGISTPEAAAVVAGNSTSRAAAQRVGPLCCRLLQHVCTQVKAT-----LLLHVQHQQ 158 AAA G++ E V+A +R R GP + L H Q +LL + + Sbjct 305 AAALGVTLAERTVVLAVEVFAREKGMRCGPKTVKALTHFLAQDGTVGHLLYVLLRARKNE 364 Query 159 LRPEAEVFPDTAFAMDE 175 L PE P T F+ +E Sbjct 365 LLPEFRDLPHTTFSEEE 381 > 381666.H16_A1986 Length=766 Score = 32.3 bits (72), Expect = 9.4, Method: Compositional matrix adjust. Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 23/80 (28%) Query 139 LQHVCTQVKATLLLHVQHQQLRPEAEVFPDTAFAM---DEVACL---------------- 179 L+ +C + TLL H QH +A+++P A + D +A + Sbjct 661 LRRLCASLSGTLLPHEQHD----DAQLYPQLALLVGGEDPLAAMSAMHREIFRVIRLLQR 716 Query 180 LAQDGAPNGSDNGRQQQQQQ 199 +A D P+G D GR ++ Q+ Sbjct 717 MADDSPPDGPDAGRVREYQR 736 Lambda K H 0.324 0.132 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47774528022 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40