bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0469_orf1 Length=133 Score E Sequences producing significant alignments: (Bits) Value 8090.ENSORLP00000004843 33.5 2.1 10090.ENSMUSP00000081324 32.0 4.9 > 8090.ENSORLP00000004843 Length=489 Score = 33.5 bits (75), Expect = 2.1, Method: Composition-based stats. Identities = 25/82 (30%), Positives = 31/82 (37%), Gaps = 5/82 (6%) Query 19 KGRMLSESKEFATPSAPATAIAAAAGVRG--VSRSGSRLLDRQRATSRAGCSIGCSTGHQ 76 KGR L +KEF + + AA V R RQ R G C H Sbjct 12 KGRGLKAAKEFWAGDVIFSEASLAAVVFDSLAERVCHSCFRRQEKLQRCG---QCKFAHY 68 Query 77 YSRSSSCCGWKQHKQSSSAARG 98 R+ GW +HKQ SA + Sbjct 69 CDRTCQRAGWAEHKQECSAIKA 90 > 10090.ENSMUSP00000081324 Length=7356 Score = 32.0 bits (71), Expect = 4.9, Method: Composition-based stats. Identities = 35/116 (30%), Positives = 49/116 (42%), Gaps = 25/116 (21%) Query 30 ATPSAPATAIAAAAGVRGVSRSGSRLLDRQRA-----TSRAG----CSIGCSTGHQY--- 77 + PS+PAT A+G + +S SGS+L A TS AG S STG + Sbjct 7215 SMPSSPATP---ASGTKVISSSGSKLKRPTPAFHSSRTSLAGDTSNSSSPASTGAKANRA 7271 Query 78 ----------SRSSSCCGWKQHKQSSSAARGTSLLQTAAACLHPGEGHVAAARTAS 123 SR+ S G + + S A LL+T +AC E A + +S Sbjct 7272 DPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGSS 7327 Lambda K H 0.314 0.123 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22766716098 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40