bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0015_orf3 Length=314 Score E Sequences producing significant alignments: (Bits) Value 246197.MXAN_3980 35.4 2.4 7955.ENSDARP00000092093 35.4 2.5 326424.FRAAL6682 33.5 9.2 > 246197.MXAN_3980 Length=349 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 9/95 (9%) Query 97 GVLKGHVEDLTCTIEFLGASGLHENFVEAMLLADTLPFMERLGVRKVVLKSIPICDAGMV 156 GV++G V T + G L V+ + D LPF E+ + V ++ MV Sbjct 243 GVIQGMVNYYTLQMTARGL--LTTGLVDLLAFQDGLPFSEQRRLLWVAMQD-------MV 293 Query 157 GLAAELGFVIKASSGDSHLMVRDGSLPPPDTDCIT 191 A+ ++++ +HLM+R G LP P +T Sbjct 294 AQGADCAAMLRSPCTPTHLMLRSGWLPFPGGSRVT 328 > 7955.ENSDARP00000092093 Length=271 Score = 35.4 bits (80), Expect = 2.5, Method: Compositional matrix adjust. Identities = 31/120 (25%), Positives = 52/120 (43%), Gaps = 8/120 (6%) Query 32 TSEREVFDTVVVKASSALSPQEQMRAARFVREKAKGELYRGAVVDSGYPTSFSV--VAVG 89 T+E F V +A S A RFV+E + G + GY S + + G Sbjct 94 TAEELPFPDASVDLLTAASAAHWFDAERFVKEAQRVLKPHGCLALFGYNDSMKIHHESCG 153 Query 90 NETGTVYGVLKGHVEDLTCTIEFLGASGLHENFVEAMLLAD-----TLPFMERLGVRKVV 144 ++ +Y LK ++ T T + GAS ++ E + D T+P E+L V+ ++ Sbjct 154 DQLNIIYEELKQELQPYTST-KVTGASTKLKDLFEVIPFPDKERIETIPIKEQLSVKNIL 212 > 326424.FRAAL6682 Length=493 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 29/95 (30%), Positives = 39/95 (41%), Gaps = 6/95 (6%) Query 140 VRKVVLKSIPICDAGMVGLAAELGFVIKASSGDSHLMVRDGSLPPPDTDCITLPRSFRAQ 199 VR +V S + + G V+ S+G HLM G P TD + P + R Sbjct 351 VRGIVPGSPTLAPRPVASAVGPGGAVVDTSAGTVHLMAGTGGSSSPSTDTLLDPPAGRIV 410 Query 200 YGVLKNFEG-RHRAPIDGKYLDVLELARMMVYEAP 233 GV G RHRA + LE A + + AP Sbjct 411 VGVRDPEPGRRHRAAV-----RALEDAAWLAFRAP 440 Lambda K H 0.321 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 111152538498 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40