bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0015_orf2 Length=110 Score E Sequences producing significant alignments: (Bits) Value 31033.SINFRUP00000131422 34.7 0.90 391735.Veis_4130 33.9 1.3 8364.ENSXETP00000032211 32.7 3.6 > 31033.SINFRUP00000131422 Length=949 Score = 34.7 bits (78), Expect = 0.90, Method: Composition-based stats. Identities = 22/70 (31%), Positives = 31/70 (44%), Gaps = 2/70 (2%) Query 12 CAINPAPPLAPS-LPGMRGGSTAQSFRWRLGEEKCGAIHRHAFTWYDRQPPTVLHCHTLR 70 C P+ P PS L GGST Q++ G +H ++ TW +PP+ +L Sbjct 667 CHTLPSHPGTPSRLSESHGGSTVQTYHTLPHPTSFGTLHSNSLTWGPLEPPSTQKPWSLS 726 Query 71 S-RPQPAHPP 79 RP P P Sbjct 727 CLRPAPPLRP 736 > 391735.Veis_4130 Length=765 Score = 33.9 bits (76), Expect = 1.3, Method: Compositional matrix adjust. Identities = 30/82 (36%), Positives = 32/82 (39%), Gaps = 20/82 (24%) Query 38 WRLGEEKCGAIHRHAFTWYDRQPPTVL----------HCHTLRSRPQPAHPPFRVARRPV 87 WRL + GAIH H+ YD P L H LR RP H RPV Sbjct 309 WRLAPREYGAIHFHSDDIYDCGWPATLVLDVPLDWRSGVHALRLRPAATH-------RPV 361 Query 88 D--ARSARVFFGPLFFVPAVGC 107 D AR A F F PA G Sbjct 362 DAPARHAETFI-TFFVTPAAGA 382 > 8364.ENSXETP00000032211 Length=472 Score = 32.7 bits (73), Expect = 3.6, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 0/49 (0%) Query 40 LGEEKCGAIHRHAFTWYDRQPPTVLHCHTLRSRPQPAHPPFRVARRPVD 88 G+E G +HR Y +QPPT L RS P+ F V RR V+ Sbjct 13 FGKEDNGFVHRIPALLYIQQPPTFLAFAEKRSSPRDQDALFIVMRRGVE 61 Lambda K H 0.327 0.138 0.488 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23096258976 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40