bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0015_orf1 Length=133 Score E Sequences producing significant alignments: (Bits) Value 264730.PSPPH_1007 34.3 1.1 > 264730.PSPPH_1007 Length=415 Score = 34.3 bits (77), Expect = 1.1, Method: Composition-based stats. Identities = 29/101 (28%), Positives = 46/101 (45%), Gaps = 9/101 (8%) Query 2 IIRANSRTSRYLPSIGALWRPSKFLRTPY--CARNDRGKVMQSVSGGGREPSLTIKCESP 59 +I SR+ Y+ + A +R L P R+ G +QS G R + C S Sbjct 206 VIEGGSRS--YVEPLTASFRERIRLSCPVTRVERDSDGVTLQSAMGSERFDKVVFACHSD 263 Query 60 E-LALITKPNSAARPTMPASQIG----MLFSTTFLTPRRSM 95 + LAL+ KP+SA + + A + +L + T L P R + Sbjct 264 QALALLAKPSSAEQSVLGALRYAENDVVLHTDTRLLPERKL 304 Lambda K H 0.317 0.128 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22766716098 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40