bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8619_orf1 Length=169 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_120220 ubiquinol-cytochrome c reductase domain-cont... 136 3e-32 pfa:PF14_0373 ubiquinol-cytochrome c reductase iron-sulfur sub... 109 3e-24 bbo:BBOV_III009930 17.m07861; ubiquinol cytochrome c oxidoredu... 78.2 1e-14 tpv:TP04_0913 ubiquinol-cytochrome C reductase, iron-sulfur su... 72.0 1e-12 ath:AT5G10940 transducin family protein / WD-40 repeat family ... 33.9 0.27 ath:AT5G12890 UDP-glucoronosyl/UDP-glucosyl transferase family... 31.2 1.6 xla:100127348 esco1, eco1, xeco1; establishment of cohesion 1 ... 29.6 5.1 dre:415194 lysmd3, sb:cb462, wu:fb75a04, zgc:86877; LysM, puta... 29.3 7.1 > tgo:TGME49_120220 ubiquinol-cytochrome c reductase domain-containing protein (EC:1.10.2.2); K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] Length=487 Score = 136 bits (343), Expect = 3e-32, Method: Compositional matrix adjust. Identities = 68/112 (60%), Positives = 82/112 (73%), Gaps = 5/112 (4%) Query 58 GPMRSFSSFNHNIGPHKSDPPASEKPLYLNRFDQADDPALFQLEAQQLEQQRLLKGQTSD 117 P R FS +HNI P K + PASE PLY NRFDQAD P+L+QLE EQQR K + Sbjct 154 SPRRHFSVHSHNIRPDKHELPASEVPLYYNRFDQADHPSLWQLEE---EQQR--KHLDQE 208 Query 118 IVDTANVVQPSNHPHQRKGFLKRMRYWHYHQTAEPTFPRTPDLSKGELAAGA 169 + D + +V+P + PHQ +G+ KR+RYWHY +TAEPTFPRTPDLSKGELAAGA Sbjct 209 VTDVSQLVEPVSSPHQTEGWFKRLRYWHYKETAEPTFPRTPDLSKGELAAGA 260 > pfa:PF14_0373 ubiquinol-cytochrome c reductase iron-sulfur subunit, putative; K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] Length=355 Score = 109 bits (273), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 54/109 (49%), Positives = 72/109 (66%), Gaps = 7/109 (6%) Query 61 RSFSSFNHNIGPHKSDPPASEKPLYLNRFDQADDPALFQLEAQQLEQQRLLKGQTSDIVD 120 R+ +FNHNI ++ PPASE P Y N FD A+D L+++E +Q + ++ D Sbjct 27 RNGGTFNHNIKENERIPPASEDPSYKNLFDHAEDIKLWEIEEKQNVSHKKVE-------D 79 Query 121 TANVVQPSNHPHQRKGFLKRMRYWHYHQTAEPTFPRTPDLSKGELAAGA 169 + +V+PSNHPHQ +G R RY HY+QTAEP FPR PDL KGELA+GA Sbjct 80 LSELVEPSNHPHQYEGIFARTRYAHYNQTAEPVFPRKPDLEKGELASGA 128 > bbo:BBOV_III009930 17.m07861; ubiquinol cytochrome c oxidoreductase (EC:1.10.2.2); K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] Length=332 Score = 78.2 bits (191), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 47/112 (41%), Positives = 63/112 (56%), Gaps = 13/112 (11%) Query 61 RSFSS-FNHNIGPHKSDPPASEKPLYLNRFDQADDPALFQLEAQQLEQQRLLKGQTSDIV 119 RSF+S +H I + P ASE+PLY N FD+A+ PAL+ L+ + E+Q S + Sbjct 5 RSFASVLHHEIKKTRYMPAASERPLYRNVFDRAEHPALWALDKTRFEKQ-------SSVE 57 Query 120 DTANVVQPSNHPHQ--RKGFLKRMRYWHYHQTAEPTFPRTPDLSKGELAAGA 169 +++ P H H R G K Y HY EP FPRTPD+ KGEL +GA Sbjct 58 SLGDLITPHAHGHTFARGGITK---YAHYVNVWEPVFPRTPDVMKGELISGA 106 > tpv:TP04_0913 ubiquinol-cytochrome C reductase, iron-sulfur subunit (EC:1.10.2.2); K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] Length=339 Score = 72.0 bits (175), Expect = 1e-12, Method: Compositional matrix adjust. Identities = 39/93 (41%), Positives = 54/93 (58%), Gaps = 8/93 (8%) Query 77 PPASEKPLYLNRFDQADDPALFQLEAQQLEQQRLLKGQTSDIVDTANVVQPSNHPHQRKG 136 P ASE PLY N FD+AD+P L+ ++ + E+ + + + +++V P H H G Sbjct 29 PAASEMPLYRNVFDRADNPRLWSMDNTKYEK-------SGPVTELSDLVTPHGHGHL-FG 80 Query 137 FLKRMRYWHYHQTAEPTFPRTPDLSKGELAAGA 169 RY HY EP FPRTPD+SKGEL +GA Sbjct 81 NTGVTRYAHYVNVWEPVFPRTPDISKGELISGA 113 > ath:AT5G10940 transducin family protein / WD-40 repeat family protein; K11807 WD and tetratricopeptide repeats protein 1 Length=757 Score = 33.9 bits (76), Expect = 0.27, Method: Compositional matrix adjust. Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 11/108 (10%) Query 27 TLTSNGAFPFLKHGGQHSLLRTGNNGVGSVG------GPMRSFSSFNHNIGPHKSDPPAS 80 T + NG L + G+H L NNG+ S G G + + SF++N+ +S P S Sbjct 286 TFSPNGEEVLLSYSGEHVYLMNVNNGICSTGIMQYTPGDVDNLFSFSNNLHDVESPPQVS 345 Query 81 EKPLYLNRFDQADDPALFQLEAQQLEQQRLLKGQTSDI---VDTANVV 125 P N F ++ + A + + +E + + +D+ ++ AN V Sbjct 346 TTP--QNGFHRSSNAATVKKCTELVEIAKWSLEEGTDVFYAIEAANEV 391 > ath:AT5G12890 UDP-glucoronosyl/UDP-glucosyl transferase family protein Length=488 Score = 31.2 bits (69), Expect = 1.6, Method: Compositional matrix adjust. Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 0/54 (0%) Query 14 RPLLLPRQIGFVSTLTSNGAFPFLKHGGQHSLLRTGNNGVGSVGGPMRSFSSFN 67 R LL+ + V L+ FL H G +S+L + ++GV +G PM + FN Sbjct 350 RGLLVKKWAPQVDILSHKATCVFLSHCGWNSILESLSHGVPLLGWPMAAEQFFN 403 > xla:100127348 esco1, eco1, xeco1; establishment of cohesion 1 homolog 1; K11268 N-acetyltransferase [EC:2.3.1.-] Length=967 Score = 29.6 bits (65), Expect = 5.1, Method: Composition-based stats. Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Query 105 LEQQRLLKGQTSDIVDTANVVQPSNHPHQRKGFLKRMRYWHY---HQTAEPTFPRTP 158 LE+ + K + S IV +A PS P +K +KR + H T+ PT P P Sbjct 379 LEKSQRPKQKRSSIVASAKKKSPSAKPPHKKLTVKRQKTGHSGTAKNTSAPTLPDVP 435 > dre:415194 lysmd3, sb:cb462, wu:fb75a04, zgc:86877; LysM, putative peptidoglycan-binding, domain containing 3 Length=305 Score = 29.3 bits (64), Expect = 7.1, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Query 55 SVGGPMRSFSSFN--HNIGPHKSDPPA 79 S+ P+R FSSF HN PHKS P+ Sbjct 109 SLRIPVRKFSSFTETHNTAPHKSSSPS 135 Lambda K H 0.318 0.135 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4222647260 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40