bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8513_orf1 Length=155 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_073460 eukaryotic translation initiation factor 3 s... 68.2 1e-11 pfa:PFF0590c homologue of human HSPC025; K15029 translation in... 41.2 0.001 tpv:TP02_0247 hypothetical protein; K15029 translation initiat... 33.1 0.41 > tgo:TGME49_073460 eukaryotic translation initiation factor 3 subunit 6 interacting protein, putative ; K15029 translation initiation factor 3 subunit L Length=639 Score = 68.2 bits (165), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 33/62 (53%), Positives = 45/62 (72%), Gaps = 1/62 (1%) Query 95 HQQRERVEAE-LADEDLDRMMAERVAFEPEVETFLRELYDKLYVRCTDSVRRLYEFDYPS 153 +Q + VE E L D LDRMM E+V FE +VE FLR LYD++Y R D++RRLYE ++P+ Sbjct 44 NQASQNVEGEGLDDAALDRMMGEKVRFENDVEEFLRSLYDEVYDRNVDAIRRLYEVEFPA 103 Query 154 LS 155 L+ Sbjct 104 LT 105 > pfa:PFF0590c homologue of human HSPC025; K15029 translation initiation factor 3 subunit L Length=656 Score = 41.2 bits (95), Expect = 0.001, Method: Composition-based stats. Identities = 17/45 (37%), Positives = 33/45 (73%), Gaps = 0/45 (0%) Query 111 DRMMAERVAFEPEVETFLRELYDKLYVRCTDSVRRLYEFDYPSLS 155 + ++ E V+FE EVETFL L+D +Y R +++++L++ D+ ++S Sbjct 9 ENVIEEIVSFEEEVETFLINLHDFVYHRNAEAIKKLFDTDFYTIS 53 > tpv:TP02_0247 hypothetical protein; K15029 translation initiation factor 3 subunit L Length=544 Score = 33.1 bits (74), Expect = 0.41, Method: Composition-based stats. Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 0/44 (0%) Query 105 LADEDLDRMMAERVAFEPEVETFLRELYDKLYVRCTDSVRRLYE 148 LA + R + + + EPEV FL L+D LY + ++++ LYE Sbjct 11 LATDGPQRTVTQLLPIEPEVVDFLVRLHDNLYRKNAEALKNLYE 54 Lambda K H 0.316 0.123 0.352 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3386671600 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40